SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019211 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019211
Domain Number 1 Region: 566-809
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.45e-83
Family Eukaryotic proteases 0.00000000611
Further Details:      
 
Domain Number 2 Region: 367-467
Classification Level Classification E-value
Superfamily Kringle-like 6.52e-39
Family Kringle modules 0.00000691
Further Details:      
 
Domain Number 3 Region: 90-183
Classification Level Classification E-value
Superfamily Kringle-like 4.83e-37
Family Kringle modules 0.00000774
Further Details:      
 
Domain Number 4 Region: 273-361
Classification Level Classification E-value
Superfamily Kringle-like 1.88e-35
Family Kringle modules 0.00000815
Further Details:      
 
Domain Number 5 Region: 464-563
Classification Level Classification E-value
Superfamily Kringle-like 3.87e-34
Family Kringle modules 0.0000062
Further Details:      
 
Domain Number 6 Region: 184-266
Classification Level Classification E-value
Superfamily Kringle-like 5.56e-34
Family Kringle modules 0.00000623
Further Details:      
 
Domain Number 7 Region: 19-100
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 3.73e-21
Family Hairpin loop containing domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019211   Gene: ENSPPYG00000017153   Transcript: ENSPPYT00000019967
Sequence length 810
Comment pep:known chromosome:PPYG2:6:164236598:164295362:1 gene:ENSPPYG00000017153 transcript:ENSPPYT00000019967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLRAGSIEECAAKCEEEKEFT
CRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKN
GITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDAQGPWCYTTDPEHRYDYCDIPE
CEEACMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDGE
PRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQRWS
AQTPQTHNRTPENFPCKNLDENYCRNPDGEKAPWCYTTNSQVRWEYCKIPSCDSSPVSTE
QLDPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHWHQKTPENYPDAG
LTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEGSVVAPPPVAQLPNVETPSEED
CMFGNGKGYRGKRATTVTGTPCQEWAAQEPHRHSIFTPQTNPRAGLEKNYCRNPDGDEGG
PWCYTTNPRKHYDYCDVPQCASSSFDCGKPQVEPKKCPGRVVGGCVANAHSWPWQVSLRT
RFGTHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE
PTRADIALLKLSSPAVITDKVIPACLPSPNYVVAGRTECFITGWGETQGTFGAGLLKEAQ
LPVIENKVCNRYEFLNGRVKSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSW
GLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Download sequence
Identical sequences H2PKT3
9600.ENSPPYP00000019211 ENSPPYP00000019211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]