SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019622 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019622
Domain Number 1 Region: 23-112
Classification Level Classification E-value
Superfamily FKBP-like 0.0000000000000216
Family FKBP immunophilin/proline isomerase 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019622   Gene: ENSPPYG00000017506   Transcript: ENSPPYT00000020394
Sequence length 189
Comment pep:novel chromosome:PPYG2:7:14709226:14756287:-1 gene:ENSPPYG00000017506 transcript:ENSPPYT00000020394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGGGDLVAPDASVLVK
YSGYLEHMDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMRRGELARCFVLGKLLDSK
GPNLHLLPQSLLNLHLQPHLPPASPLLPGPSALHPWDLRITPSGAAELPLPGPQNYPFRF
SCVTFRLPS
Download sequence
Identical sequences H2PLY7
ENSPPYP00000019622 ENSPPYP00000019622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]