SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020130 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020130
Domain Number 1 Region: 1698-2000
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.24e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000275
Further Details:      
 
Domain Number 2 Region: 37-300
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.11e-75
Family Carbonic anhydrase 0.0000075
Further Details:      
 
Domain Number 3 Region: 2000-2284
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.8e-71
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000135
Further Details:      
 
Domain Number 4 Region: 309-409
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000853
Family Fibronectin type III 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020130   Gene: ENSPPYG00000017949   Transcript: ENSPPYT00000020922
Sequence length 2317
Comment pep:known_by_projection chromosome:PPYG2:7:118733047:118928041:1 gene:ENSPPYG00000017949 transcript:ENSPPYT00000020922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRILKRFLACIHLLCVCRLDWANGYYRQQRKLVEEIGWSYTGALNQKNWGKKYPTCNSPK
QSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMV
FKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALS
VLFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPC
TDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
TGKEEIHEAVCSSEPENVQADPENYTSLLVTWERPRVVYDTMIEKFAVLYQQLDGEDQTK
HEFLTDGYQDLGAILNNLLPNMSYVLQIVAICTNGLYGKYSDQLIVDMPTDNPELDLFPE
LIGTEEIIKEEEEGKDIEEGAVVNPGRDSATNQIRKKEPQISTTTHYNRIGMKYNEAKTN
RSPTRGSEFSGKGDVPNTSLNSTSQPVTKLATEKDISLTSQTVTELPSHTVEGTSASLND
DSKTVLRSPHMNLSGTAESLNTVSITEYEEESLLTSFKLDTGAEDSSGSSPATSAIPFIS
ENISQGYIFSSENPETITYDVLILESARNASEDSTSSGSEESLKDPSVEGNVWFPSSTDV
TAQPDVGSGRESFLQTNYTEIRVDESEKTTKSFSAGPVMSQGPSVTDLEMPHYSTFAYFP
TEVTPHASTPSSRQQDLVSTVNVVHSQTTQPVYNGETPLQPSYSSGVFPLVTPLLLDNQI
LNTTPAASSSDSALHATPVFPSVDVSFESILSSYDGAPLLPFSSASFSSELFRHLHTVSQ
ILPQVTSATESDKVPLHASLPVAGGDLLLEPSLAQYSDVLSTTHAASETLEFGSESGVFY
KTLMFSQVEPPSSDAMMHARSSGPEPSYALSDNEGSQHIFTVSYSSAIPVHDSVGVTYQG
SLFSGPSHIPIPKSSLITPTASLLQPTHALSGDGEWSGASSDSEFLLPDTDGLTALNISS
PVSVAEFTYTTSVFGDDNKALSKSEIIYGNETELQIPSFNEMVYPSEITVMPNMYDNVNK
LNASLQETSVSISSTKGMFPGSLAHTTAKVFDHEISQVPENNFPVQPTHTVSQASGDTSL
KPVLSANSEPAFSDPASSEMLSPSTQLLFYETSASFSTEVLLQPSFQASDVDTLLKTVLP
AVPSDPILVETPKVDKISSTMLHLIVSNSASSENMLHSTSVPVFDVSPTSHMHSASLQGL
TISYASEKYEPVLFKSESSHQVVPSLYSNDELFQTANLEINQAHPPKGRHAFATPVLSID
EPLNTLINKFIHSDEILTSTKSSVTDKVFAGIPTVASDTFVSTDHSVPIGNGHVAITAVS
PNRDGSVTSTKLLFPSKATSELSHSAKSEADLVGGGEDGDTDDDDGDDDDDDDRDSDGLS
IHKCMSCSSYRESQEKVMNDSDTHENRLMDENNPISYSLSENSEEDNRVTSVSSDSQTGM
DRSPGKSPSANGLSQKPSDGKEENDIQTGSALLPLSPESKAWAVLTSDEESGSGQGTSDS
LNENETSTDFSFADTNEKDADGILAAGDSEISPGFPQSPTPSVTSENSEVFHVSEAEASN
SSHESRIGLAEGLESEKKAVIPLVIVSALTFICLVVLVGILIYWRKCFQTAHFYLEDSTS
PRVISTPPTPIFPISDDVGAIPIKHFPKHVADLHASSGFTEEFETLKEFYQEVQSCTVDL
GITADSSNHPDNKHKNRYINIVAYDHSRVKLAQLAEKDGKLTDYINANYVDGYNRPKAYI
AAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPADGSEEYGNFMVTQKS
VQVLAYYTVRNFTLRNTKIKKGSQKGRSSGRMVTQYHYTQWPDMGVPEYSLPVLTFVRKA
AYAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQT
EEQYVFIHDTLVEAILSKETEVLDNHIHAYVNALLIPGPAGETKLERQFQLLSQSNIQQS
DYSTALKQCNREKNRTSSIIPVERSRVGISSLNGEGTDYINASYIMGYYQSNEFIITQHP
LLHTIKDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPNKDEPINCESFKVTLMAEEHKC
LSNEEKLIIQDFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISVIKEEAANRDGP
MIVHDEHGGVTAGTFCALTTLMHQLEKENSVDVYQVAKMINLMRPGVFADIEQYQFLYKV
ILSLVSTRQEENPSTSLDSNGAALPDGNIAESLESLV
Download sequence
Identical sequences H2PNB9
XP_002818423.1.23681 ENSPPYP00000020130 ENSPPYP00000020130 9600.ENSPPYP00000020130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]