SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020190 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000020190
Domain Number - Region: 247-342
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 0.00065
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020190   Gene: ENSPPYG00000017996   Transcript: ENSPPYT00000020983
Sequence length 522
Comment pep:known_by_projection chromosome:PPYG2:7:126523423:126670161:1 gene:ENSPPYG00000017996 transcript:ENSPPYT00000020983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPEDTSYDDSDILN
STAADEVTAHLAAAGPVGMAAAAAVATGKKRKRPHVFESNPSIRKRQQTRLLRKLRATLD
EYTTRVGQQAIVLCISPSKPNPVFKVFGAAPLENVVRKYKSMILEDLESALAEHAPAPQE
VNSELPPLTIDGIPVSVDKMTQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPW
ANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQQTQTQATATHSIAHL
VPSQTVVQTFSNPDGTVSLIQVGTGATVATLADASELPTTVTVAQVNYSAVADGEVEQNW
ATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVTMALNSEAAAHAVATLAE
ATLQGGGQIVLSGETAAAVGALTGVQDANGLFMADRAGRKWILTDKATGLVQIPVSMYQT
VVTSLAQGNGPVQVAMAPVTTRISDSAVTMDGQAVEVVTLEQ
Download sequence
Identical sequences A0A024R774 A0A1D5QDT6 A0A2I3N2S1 A0A2I3TSH2 A0A2K5CRT8 A0A2K5KFQ6 A0A2K5NQP5 A0A2K6DKI8 A0A2K6P894 A0A2K6SX08 G1RQ67 G7P0N0 H2PNH7
ENSPPYP00000020190 ENSP00000309826 ENSP00000376923 NP_001280092.1.87134 NP_001280092.1.92137 XP_003261367.1.23891 XP_003951177.1.37143 XP_007981081.1.81039 XP_007981082.1.81039 XP_007981083.1.81039 XP_007981084.1.81039 XP_007981085.1.81039 XP_009452470.1.37143 XP_009452471.1.37143 XP_009452472.1.37143 XP_010341435.1.74449 XP_011722182.1.29376 XP_011722183.1.29376 XP_011722184.1.29376 XP_011722185.1.29376 XP_011722186.1.29376 XP_011722187.1.29376 XP_011722188.1.29376 XP_011722189.1.29376 XP_011722190.1.29376 XP_011794974.1.43180 XP_014201313.1.60992 XP_014201314.1.60992 XP_015303514.1.63531 XP_015303515.1.63531 XP_015303516.1.63531 XP_016813640.1.37143 XP_016813641.1.37143 XP_017388069.1.71028 XP_021529361.1.9421 ENSP00000342351 9598.ENSPTRP00000033711 9600.ENSPPYP00000020190 ENSNLEP00000015381 ENSP00000309826 ENSP00000342351 ENSPPYP00000020191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]