SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020277 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020277
Domain Number 1 Region: 25-232
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.07e-39
Family Eukaryotic proteases 0.0000674
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020277   Gene: ENSPPYG00000018071   Transcript: ENSPPYT00000021073
Sequence length 235
Comment pep:known_by_projection chromosome:PPYG2:7:139105709:139110402:-1 gene:ENSPPYG00000018071 transcript:ENSPPYT00000021073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKYVFYLGVLAGTFFFADSSVQKEDPAPYLVYLKSHFNPCVGVLIKPSWVLAPAHCYLPN
LKVMLGNFKSRVRDGTEQTINPIQIVRYWNYSHSAPQDDLMLIKLAKPAMLNPKVQPLPL
ATTNVRPGTVCLLSGLDWSQENSGRHPDLRQNLEAPVMSDRECQKTEQGKSHRNSLCVKF
VKVFSRIFGEVAVATVICKDKLQGIEVGHFMGGDVGIYTNVYKYVSWIENTAKDK
Download sequence
Identical sequences H2PNR1
XP_002818590.2.23681 XP_009241586.1.23681 9600.ENSPPYP00000020277 ENSPPYP00000020277 ENSPPYP00000020277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]