SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020281 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020281
Domain Number 1 Region: 81-275
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.13e-33
Family YicI N-terminal domain-like 0.021
Further Details:      
 
Domain Number 2 Region: 276-441
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.26e-26
Family YicI catalytic domain-like 0.0092
Further Details:      
 
Domain Number 3 Region: 40-94
Classification Level Classification E-value
Superfamily Trefoil 0.0000000000196
Family Trefoil 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020281   Gene: ENSPPYG00000018075   Transcript: ENSPPYT00000021077
Sequence length 446
Comment pep:novel chromosome:PPYG2:7:139414085:139442037:1 gene:ENSPPYG00000018075 transcript:ENSPPYT00000021077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKLSVLEVLLIIFCLIVVTIDILLLLLVLEETSDTSFTPECPEIPQSERIDCTPDQEV
TEDICRWQYKCCWSPVVDANVPRCFFPWNWGYEASNGHTNTSTGFTAQLKRLPSPSLFGN
DVATTLFTAEYQTSNRFHFKITDFNNIRYEVSHENVNLVDGTADASNLSYYVEVTDKPFS
IKIMRSNRVLLDTSIGPLQYAQQYLQLSFRLPSANVYGLGEHVHQQYRHNMTWKTWPIFT
RDATPTEVTLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELVGRPFLPPYWSLGFQ
LSRRDYGGINKLKEVVSRNRLAEIPYDVQYSDIDYMDGKKDFTVDEVAYSGLPDFVKELH
DNGQKYLIIMNPGISKNSKYEPYNNGSLKRVWILGNNGFAVGEGYPGPTVFPDYTNPVCT
EWWTDQVAKFHDHLEFDGVWIVSYYC
Download sequence
Identical sequences H2PNR5
9600.ENSPPYP00000020281 ENSPPYP00000020281 ENSPPYP00000020281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]