SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020282 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020282
Domain Number 1 Region: 3-240
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.1e-57
Family Eukaryotic proteases 0.0000671
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020282   Gene: ENSPPYG00000018076   Transcript: ENSPPYT00000021078
Sequence length 241
Comment pep:known_by_projection chromosome:PPYG2:7:139591793:139597605:-1 gene:ENSPPYG00000018076 transcript:ENSPPYT00000021078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFILLWALLNLTVALAFNPDYTVSSTPPYLVYLKSDYLPCAGVLIHPLWVITAAHCNLP
KLRVILGVTIPADSNEKHLQVIGYEKMIHHPHFSITSIDHDIMLIKLKTEAELNDYVKLA
NLPYQTISENTMCSVSTWSYNVCDIYKEPDSLQTVNISVISKPQCRDAYKTYNIKENMLC
VGIVPGRRQPCKEVSAAPAICNGMLQGILSFADGCVLRADVGIYAKIFYYIPWIENVIQN
N
Download sequence
Identical sequences H2PNR6
ENSPPYP00000020282 XP_002818602.1.23681 9600.ENSPPYP00000020282 ENSPPYP00000020282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]