SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020308 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020308
Domain Number 1 Region: 9-244
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.1e-89
Family Eukaryotic proteases 0.0000000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020308   Gene: ENSPPYG00000018102   Transcript: ENSPPYT00000021104
Sequence length 247
Comment pep:known_by_projection chromosome:PPYG2:7:140244046:140282970:1 gene:ENSPPYG00000018102 transcript:ENSPPYT00000021104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPLLILTFVAAAVAAPFDDDDKIVGGYTCRKNSLPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDKKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLTQAECEASYPGKIT
NNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQKRRPGVYTNVYNYVDWIK
DTIAANS
Download sequence
Identical sequences H2PNU2
ENSPPYP00000020308 ENSPPYP00000020308 9600.ENSPPYP00000020308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]