SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020423 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020423
Domain Number 1 Region: 38-191
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 2.94e-76
Family Hedgehog (development protein), N-terminal signaling domain 0.0000000682
Further Details:      
 
Domain Number 2 Region: 196-363
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.73e-37
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020423   Gene: ENSPPYG00000018217   Transcript: ENSPPYT00000021231
Sequence length 460
Comment pep:known_by_projection chromosome:PPYG2:7:153951341:153960674:-1 gene:ENSPPYG00000018217 transcript:ENSPPYT00000021231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLARCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASG
SMKKISRNSERFKELTPNYNPDIIKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKL
RVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIH
CSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDQGRLLYSDFLTFL
DRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSAAGEPEASSGSGPPSGGALGPR
ALFASRVRPGQRVYVVAERDGDRRLLPAAVHSVTLREEAAGAYAPLTAQGTILINRVLAS
CYAVIEEHSWAHRAFAPFRLAHALLAALAPGRTDRGGDSGGGDRGGGGGRVPLPAPGAAD
APGAGATAGVHWYSQLLYQIGTWLLDSEALHPLGMAVKSS
Download sequence
Identical sequences H2PP55
ENSPPYP00000020423 9600.ENSPPYP00000020423 ENSPPYP00000020423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]