SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020452 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000020452
Domain Number - Region: 15-100
Classification Level Classification E-value
Superfamily DNA clamp 0.0141
Family DNA polymerase processivity factor 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020452   Gene: ENSPPYG00000018251   Transcript: ENSPPYT00000021265
Sequence length 176
Comment pep:novel chromosome:PPYG2:7_random:3646812:3651092:-1 gene:ENSPPYG00000018251 transcript:ENSPPYT00000021265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFRAKIVDGACLNHFTRISNMIAKLAKTCTLRISPDKLNFILCDKLANGGVSMWCELEH
EFFEFQEVSAKSELSRALKTAQNARALKIKLTNKHFPCLTVSVELLSMSSSSRIVTHDIP
IKVIPRKLWKDLQEPVVPDPDVSIYLPVLKTMKSVVEKMKNISNHLVSHNFFRKEL
Download sequence
Identical sequences H2PP84
ENSPPYP00000020452 ENSPPYP00000020452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]