SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020454 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020454
Domain Number 1 Region: 39-147
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.28e-39
Family Eukaryotic proteases 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020454   Gene: ENSPPYG00000018256   Transcript: ENSPPYT00000021270
Sequence length 148
Comment pep:novel chromosome:PPYG2:7_random:5789373:5790643:1 gene:ENSPPYG00000018256 transcript:ENSPPYT00000021270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIVPKFPLSAAFPTSDDDDKIIGLHLSEEFCPLSGSLNAGYHFCGGSLINNKWVVSAAHC
YKLSRIQVRLGEYNIKVYEGNEQFINAAKIICHPKYNSATIDNDIMLIKLSSAATINSQV
ATISLPRSCAAAGTQCLISGWGNTLSSG
Download sequence
Identical sequences H2PP86
ENSPPYP00000020454 9600.ENSPPYP00000020454 ENSPPYP00000020454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]