SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020466 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020466
Domain Number 1 Region: 187-484
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 6.08e-42
Family NadC C-terminal domain-like 0.025
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000020466
Domain Number - Region: 10-73,113-152
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 0.000989
Family NadC N-terminal domain-like 0.013
Further Details:      
 
Domain Number - Region: 87-118
Classification Level Classification E-value
Superfamily DUSP-like 0.0889
Family DUSP, domain in ubiquitin-specific proteases 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020466   Gene: ENSPPYG00000018270   Transcript: ENSPPYT00000021284
Sequence length 491
Comment pep:novel chromosome:PPYG2:7_random:11804884:11843589:-1 gene:ENSPPYG00000018270 transcript:ENSPPYT00000021284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFY
GLQYILNKYLKGKVVTKEKIQEAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVP
EGFVIPRGNVLFTVENTDPECYWLTNWIETILVQTWYPITVATNSREQKKILAKYLLETS
GNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGIALIKKYYGTKDPVPGY
SVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIV
SRSTAAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINT
LQEIVEGMKQKMWSIENIAFGSGGGLLQKLTRDLLNCSFKCSYVVTNGLGINVFKDPVAD
PNKRSKKGRLSLHRTPAGNFVTLEEGKGDLEEYGHDLLHTVFKNGKVTKSYSFDEIRKNA
QLNIELEAAHH
Download sequence
Identical sequences H2PP98
XP_009234172.1.23681 ENSPPYP00000020466 9600.ENSPPYP00000020466 ENSPPYP00000020466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]