SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020481 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020481
Domain Number 1 Region: 21-141
Classification Level Classification E-value
Superfamily FKBP-like 8.25e-26
Family FKBP immunophilin/proline isomerase 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020481   Gene: ENSPPYG00000018289   Transcript: ENSPPYT00000021303
Sequence length 195
Comment pep:known_by_projection chromosome:PPYG2:7_random:15648493:15651828:1 gene:ENSPPYG00000018289 transcript:ENSPPYT00000021303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGGGDLVAPDASVLVY
SGYLEHLDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPNYAYGTL
GCPPLIPRNTTVLFEIELLDFLNSAESDKFCALSAEQQDQFPLQKVLKVAVTEREFGNYL
FRQSRFYDAKVKYKM
Download sequence
Identical sequences H2PPB2
9600.ENSPPYP00000020481 ENSPPYP00000020481 ENSPPYP00000020481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]