SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020725 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020725
Domain Number 1 Region: 64-151,221-352
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.67e-45
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000207
Further Details:      
 
Domain Number 2 Region: 358-471
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 6.7e-37
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020725   Gene: ENSPPYG00000018489   Transcript: ENSPPYT00000021554
Sequence length 472
Comment pep:known_by_projection chromosome:PPYG2:8:30659380:30724806:-1 gene:ENSPPYG00000018489 transcript:ENSPPYT00000021554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLPRALSAGAGPSWRRAARAFRGFPLLLPEPAALTRALSSAMACRQEPQPQGPLPAAG
AVASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHS
EFMHDHADYGFPSCEGKFNWRIIKEKRDAYVSRLNTIYENNLTKASLGITSDGFFQLEEL
PSRSIIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRNFDSMISTNCTEELENAGVEVL
KFSQVKEVKKTSSGLEVSMVTAVPGTLPVMTMIPDVDCLLWAIGRDPNTKGLSLNKLGIQ
TDDKGHILVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNN
IPTVVFSHPPIGTVGLTEDEAIHKYGKENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANK
EEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
Download sequence
Identical sequences H2PPZ6
9600.ENSPPYP00000020725 ENSPPYP00000020725 ENSPPYP00000020725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]