SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020791 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020791
Domain Number 1 Region: 21-163
Classification Level Classification E-value
Superfamily GINS helical bundle-like 2.04e-49
Family SLD5 N-terminal domain-like 0.000000139
Further Details:      
 
Domain Number 2 Region: 166-223
Classification Level Classification E-value
Superfamily PriA/YqbF domain 8.5e-16
Family SLD5 C-terminal domain-like 0.0000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020791   Gene: ENSPPYG00000018543   Transcript: ENSPPYT00000021624
Sequence length 223
Comment pep:known_by_projection chromosome:PPYG2:8:42035305:42052034:1 gene:ENSPPYG00000018543 transcript:ENSPPYT00000021624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEELDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEH
MEENLRRAKREDLKVSIHQMEMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPS
SLSPEELAFAREFMANTESYLKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQE
NILVEPDTDEQRDYVIDLEKGSQHLIRYKTIAPLVASGAVQLI
Download sequence
Identical sequences A0A2I3SZ33 H2PQ60
ENSPPYP00000020791 9598.ENSPTRP00000034578 9600.ENSPPYP00000020791 XP_001138293.1.37143 XP_002819081.1.23681 XP_003823349.1.60992 XP_008975185.1.60992 XP_009242030.1.23681 XP_009242031.1.23681 XP_009453519.1.37143 ENSPPYP00000020791 ENSPTRP00000034578 ENSPTRP00000034578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]