SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020802 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020802
Domain Number 1 Region: 347-610
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2e-86
Family Eukaryotic proteases 0.000000000504
Further Details:      
 
Domain Number 2 Region: 154-259
Classification Level Classification E-value
Superfamily Kringle-like 6.04e-32
Family Kringle modules 0.00016
Further Details:      
 
Domain Number 3 Region: 262-350
Classification Level Classification E-value
Superfamily Kringle-like 1.09e-31
Family Kringle modules 0.00000743
Further Details:      
 
Domain Number 4 Region: 85-134
Classification Level Classification E-value
Superfamily FnI-like domain 1.46e-20
Family Fibronectin type I module 0.0000857
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020802   Gene: ENSPPYG00000018549   Transcript: ENSPPYT00000021635
Sequence length 611
Comment pep:known chromosome:PPYG2:8:42686907:42719675:-1 gene:ENSPPYG00000018549 transcript:ENSPPYT00000021635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAEILQESRAGEKTSARKGKEQAAGEREEGSEGRRKHAEVPEFKGRCEAIMNAMKRGLCC
VLLLCGAVFALPSQEIHARVRRGRSYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWC
NSGRAQCHSVPVRSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQ
GISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCRNPDRDSKPWCY
VFKAGKYSSEFCSTPACSEGNSDCYFGNGLAYRGTHSLTESGASCLLWNSMILIGKVYTA
QNPNAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRI
KGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQERFPPHHLTVI
LGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVCL
PPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNML
CAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGEKDVPGVYTKVTN
YLDWIHDNMRP
Download sequence
Identical sequences H2PQ69
ENSPPYP00000020802 ENSPPYP00000020803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]