SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020969 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000020969
Domain Number - Region: 72-154
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00149
Family Cold shock DNA-binding domain-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020969   Gene: ENSPPYG00000018694   Transcript: ENSPPYT00000021809
Sequence length 181
Comment pep:known_by_projection chromosome:PPYG2:8:82804289:82918882:-1 gene:ENSPPYG00000018694 transcript:ENSPPYT00000021809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALCGTRAVAAESHFLRVFLFSRPFRGVGTESGSESGSSNAKEPKTRVGGFASALERHS
ELLQKGSPKNVESFASMLRRSPLTQMGPAKDKLVVGRIFHIVGDDLYIDFGGKFHCVCRR
PEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLGIQESKDSRSKEEHHE
K
Download sequence
Identical sequences H2PQM5
ENSPPYP00000020969 ENSPPYP00000020969 XP_002819251.2.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]