SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020995 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020995
Domain Number 1 Region: 2-259
Classification Level Classification E-value
Superfamily Carbonic anhydrase 4.52e-101
Family Carbonic anhydrase 0.000000000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020995   Gene: ENSPPYG00000018718   Transcript: ENSPPYT00000021835
Sequence length 260
Comment pep:known_by_projection chromosome:PPYG2:8:88597448:88617610:1 gene:ENSPPYG00000018718 transcript:ENSPPYT00000021835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVCYDQATSLRIL
NNGHSFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHL
VHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKCADFTNFDP
RGLLPASLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQMLKFRKLNFNGEGEPEELM
VDNWRPAQPLKKRQIKASFK
Download sequence
Identical sequences H2PQQ1
XP_002819286.1.23681 ENSPPYP00000020995 9600.ENSPPYP00000020995 ENSPPYP00000020995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]