SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021108 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021108
Domain Number 1 Region: 98-142
Classification Level Classification E-value
Superfamily LysM domain 0.0000000109
Family LysM domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021108   Gene: ENSPPYG00000018815   Transcript: ENSPPYT00000021951
Sequence length 874
Comment pep:known chromosome:PPYG2:8:113055793:113559156:1 gene:ENSPPYG00000018815 transcript:ENSPPYT00000021951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVTNLSWLKKKSQSVDINAPGFNPLGGAGKQTPQASKPPAPKTPIIEEEQNNAANTQKH
PSRRSELKRFYTIDTGQKKTLDKKDGRRMSFQKPKGTIEYTVESRDSLNSIALKFDTTPN
ELVQLNKLFSRAVVTGQVLYVPDPEYVSSVESSPSLSPVSPLSPTSSEAEFDKTTNPDVH
PTEATPSSAFTGIRPARVVSSTSEEEEAFTEKFLKINCKYITSGKGTVSGVLLVTPNNIM
FDPHKTDPLVQENGCEEYGIMCPMEEVMSAAMYKEILDSKIKESLPIDIDQLSGRDFCHS
KKMTGSNTEEIDSRIRDAGNDSASTAPRSTEESLSEDVFTESELSPIREELVSSDELRQD
KSSGASSESVQTVSQAEVESLTVKSESTGTPGHLGSDTEHSTNEVGTLCHKTDLNNLEMA
IKEGDQIADNFQGISGPKEDSTSIKGNSDQDSFLHENSLHQEESQKENMPCGETAEFKQK
PSVNKGKQGKEQNQDSQTEVEELRKLWKTHTMQQTKQQRENIQQVSQKEAKHKITSADGH
IESSALLKEKRRHRLHKFLCLRVGKPMRKTFVSQASATMQQYAQRDKKHEYWFAVPQERT
DHLYAFFIQWSPEIYAEDTGEYTREPGFIVVKKIEESETIEDSSNQAAAREWEVVSVAEY
HRRIDALNTEELRTLCRRLQITTREDINSKQVAPVKADLESESFRPNLSDPSELLLPDQI
EKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQVFGALAS
EPFKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGD
LYHGRSHSCKTFGNRTLSKKEDFFIQDIEIWAFE
Download sequence
Identical sequences H2PR05
ENSPPYP00000021108 ENSPPYP00000021108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]