SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021137 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021137
Domain Number 1 Region: 151-273
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-33
Family C-type lectin domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021137   Gene: ENSPPYG00000018839   Transcript: ENSPPYT00000021980
Sequence length 277
Comment pep:known_by_projection chromosome:PPYG2:8:126675596:126715502:1 gene:ENSPPYG00000018839 transcript:ENSPPYT00000021980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGFASLLRRNQFILLVLFLLQIQSLGLDINSRPTAEVCATHTISPGPKGDDGEKGDPGE
EGKHGKVGRMGPKGIKGELGDMGDQGDIGKTGPIGKKGDKGEKGLLGIPGEKGKAGTVCD
CGRYRKFVGQLDISIARLKTSMKFVKNVIAGIRETEEKFYYIVQEEKNYRESLTHCRIRG
GMLAMPKDEAANTLIADYVAKSGFFRVFIGVNDLEREGQYVFTDNTPLQNYSNWNEGEPS
DPYGHEDCVEMLSSGRWNDTECHLTMYFVCEFIKKKK
Download sequence
Identical sequences H2PR29
ENSPPYP00000021137 XP_002819430.1.23681 ENSPPYP00000021137 9600.ENSPPYP00000021137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]