SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021169 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021169
Domain Number 1 Region: 6-234
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 5.67e-61
Family TatD Mg-dependent DNase-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021169   Gene: ENSPPYG00000018868   Transcript: ENSPPYT00000022012
Sequence length 237
Comment pep:known_by_projection chromosome:PPYG2:8:132140572:132191540:-1 gene:ENSPPYG00000018868 transcript:ENSPPYT00000022012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRFKFIDMFFSTVGCHPTRCGEFEKNNPDLYLKELLNLAENNKGKVVAIGECGLDFDRL
QFCPKDTQLKYFEKQFELSEQTKLPMFLHCRNSHAEFLDIMKRNRDRCVGGVVHSFDGSK
EAAAALIDLDLYIGFNGCSLKTEANLEVLKSIPSEKLMIETDAPWCGVKSTHAGSKYIKT
AFPTKKKWESGHCLKDRNEPCHIIQILEIMSAVRDEDPLELANTLYNNTIKVFFPGI
Download sequence
Identical sequences H2PR59
XP_009242356.1.23681 ENSPPYP00000021169 ENSPPYP00000021169 9600.ENSPPYP00000021169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]