SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021281 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021281
Domain Number 1 Region: 18-112
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 1.08e-33
Family VPS28 N-terminal domain 0.0028
Further Details:      
 
Domain Number 2 Region: 125-204
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 7.85e-23
Family VPS28 C-terminal domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021281   Gene: ENSPPYG00000018975   Transcript: ENSPPYT00000022129
Sequence length 205
Comment pep:known_by_projection chromosome:PPYG2:8:152784801:152787951:-1 gene:ENSPPYG00000018975 transcript:ENSPPYT00000022129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDC
VSPSEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKD
DKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTV
SQWLQTLSGSASDDLDHSHVRLMLF
Download sequence
Identical sequences H2PRH1
ENSPPYP00000021281 9600.ENSPPYP00000021281 ENSPPYP00000021281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]