SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021320 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021320
Domain Number 1 Region: 284-570
Classification Level Classification E-value
Superfamily Kelch motif 1.96e-65
Family Kelch motif 0.00014
Further Details:      
 
Domain Number 2 Region: 11-129
Classification Level Classification E-value
Superfamily POZ domain 6.02e-33
Family BTB/POZ domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021320   Gene: ENSPPYG00000019017   Transcript: ENSPPYT00000022175
Sequence length 581
Comment pep:known_by_projection chromosome:PPYG2:8_random:7316563:7326810:-1 gene:ENSPPYG00000019017 transcript:ENSPPYT00000022175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKESPDGLLFKDQDFSSDLLRQLNCLRQSRILTDVSICAGAQEIPCHRNVLASSSPYFR
AMFCSSFREKSEAKVQLKGIDPPTLDQIISYVYTGEARIAADNVLPVMEAASMLQFPKLF
EACSSYLQSQLAPSNCLGMIRLSEVLSCETLKKKAREVALTSFPEVAASADLKELCALEL
RDYLGDDGLCGEEEKVFEALMVWIKHDLQARKRYIQELFKQVRLQYIHPAFFHHFIASDA
LLQSSPACQIILETAKRQMFSLCGTSAPDCKLLLHVPPRNSYQDFLILLGGRKDSQQTTR
DVLLYSKQTGQWQSLAKLPTRLYKASAVTLHRSVYVLGGMAVSSGRSLVSHNVYIFSLKL
NQWRLGEPMLVARYSHRSTAYKNFIFSIGGIGEGQELMGSMERYDSICNVWESMASMPVG
VLHPAVAVKDQRLYLFGGEDIMQNPVRLIQVYHISRNSWFKMETRMIKNVCAPAVVLGER
IVIVGGYTRRILAYDPQSNKFVKCADMKDRRMHHGATVMGNKLYVTGGRRLTTDCNIEDS
SSFDCYDPETDTWTSQGQLPHKLFDHACLTLQCIPRTSALP
Download sequence
Identical sequences H2PRL0
ENSPPYP00000021320 ENSPPYP00000021320 XP_002833133.1.23681 9600.ENSPPYP00000021320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]