SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021389 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021389
Domain Number 1 Region: 146-396
Classification Level Classification E-value
Superfamily Carbonic anhydrase 6.54e-79
Family Carbonic anhydrase 0.00000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021389   Gene: ENSPPYG00000019090   Transcript: ENSPPYT00000022255
Sequence length 465
Comment pep:known_by_projection chromosome:PPYG2:9:25879067:25886537:-1 gene:ENSPPYG00000019090 transcript:ENSPPYT00000022255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLCPSPWLPLLNPAPAPGLTVQLLLSLLLLVPAHPQRLPRMQEDSPLGGDFSGEDDPL
GKEDLPSEEDSPREEDPPREEDPPGEEDLPGEEDLPGEEDLPEVKPKSEEEGSLKLEDLP
TVEAPGDPQEPKNNAHRDKEGDDQSHWRYGGDPPWPQVSPACAGRFQSPVDIRPQLAAFC
LALRPLELLGFQLPPLPELRLRNNGHSVQLTLPPGLEMALGPGREYRALQLHLHWGAAGR
PGSEHTVEGHRFPAEIHVVHLSTAFARVEEALGRPGGLAVLAAFLEEGPEENSAYEQLLS
HLEEIAEEGSETQVPGLDISALLPSDLSRYFRYEGSLTTPPCAQGVIWTVFNQTVMLSAK
QLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCLAAGD
ILALVFGLLFAITSVAFLVQMRRQHRRATKGGVSYRPAEVAETGA
Download sequence
Identical sequences H2PRS8
9600.ENSPPYP00000021389 ENSPPYP00000021389 ENSPPYP00000021389 XP_002819693.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]