SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021436 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021436
Domain Number 1 Region: 78-300
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.31e-85
Family Eukaryotic proteases 0.0000000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021436   Gene: ENSPPYG00000019131   Transcript: ENSPPYT00000022303
Sequence length 303
Comment pep:known_by_projection chromosome:PPYG2:9:27829531:27878966:-1 gene:ENSPPYG00000019131 transcript:ENSPPYT00000022303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGPDDRCPARWPGPGRAVKGGKGLAAARPDRVERGGARRGGAGLELHLLLGGRTWLAAR
AADGCETLGTVAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCSGSLINEQWVLSAAH
CYETHIQVRLGEHNIKVLEGNEQFINAAKIIRHPYNRDTPDNDIMLIKLSSPAVINARVS
TISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMF
CVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGYGCALKNRPGVYTKVYNYVDWIKDTIA
ANS
Download sequence
Identical sequences H2PRX3
ENSPPYP00000021436 9600.ENSPPYP00000021436 ENSPPYP00000021436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]