SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021517 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021517
Domain Number 1 Region: 2012-2179
Classification Level Classification E-value
Superfamily C-type lectin-like 1.5e-28
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 2 Region: 1741-1853
Classification Level Classification E-value
Superfamily CalX-like 3.01e-20
Family CalX-beta domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000021517
Domain Number - Region: 391-428
Classification Level Classification E-value
Superfamily Purple acid phosphatase, N-terminal domain 0.0112
Family Purple acid phosphatase, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021517   Gene: ENSPPYG00000019211   Transcript: ENSPPYT00000022394
Sequence length 2180
Comment pep:known_by_projection chromosome:PPYG2:9:47424558:47557391:1 gene:ENSPPYG00000019211 transcript:ENSPPYT00000022394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSLSWGAANALLLLLLLAWASPTFISINRGVRVMKGHSAFLSGDDLKFAIPKEKDACKV
EVVMNEPITQRVGKLTPQVFDCHFLPNEVKYVHNGCPILDEDTVKLRLYRFTETDTFIET
FILWVYLLEPDCNIIRMSNNVLEVPEFNGLSQAIDKNLLRFDYDRMASLECTVSLDTART
RLPAHGQMVLGKPRPEEPRGDQPHSFFPESQLGAKLKCPGGSCTPGLKKIESLKVSCEEF
LLMGLRYQHLDPPSPNIDYISIQLDLTDTRSKIVYKKSESAWLPVYIRAGIPNQIPKAAF
MAMFILEVDQFILTSLTTSVLDCEEDETPKPLLVFNITKAPLQGYVTHLLDHTRPISSFT
WKDLSDMQIAYQPPNSSHSERRHDEVELEVYDFFFERSAPMTVHISIRTADTNAPRVSWN
TGLNLLEGQSRAITWEQFQVVDNDDIGAVRLVTVGGLQHGWLTLRGGKGFLFTVADLQAG
VVRYHHDDSDSTKDFVVFRIFDGHHSIRHKFPINVLPKDDSPPFLITNVVIELEEGQTIL
IQGSMLRASDVDASDDYIFFNITKPPQAGQIMKKPGPGVIGYPVPGFLQRDLFNGIIYYR
HFGGEIFEDSFQFVLWDSHEPPNLSVPQMATIHITPVDDQLPKEAPGVSRHLVVKETEVA
YITKKQLHFIDSESYDRELVYTITTPPFFSFSHRHLDAGKLFMVDSIPKVVKNPTALELR
SFTQQAVNYMKVAYMPPMQDIGPHCRDVQFTFSVSNQHGSTLHGICFNITILPVDNQVPE
VFTNPLKVTEGGQSVISTEHILISDADTKLDNIDLSLRGLPLHGRVELNGFPLNSGGTFS
WGDLHTLKVRYQHDGSEVLQDDILLEVTDGTNSAEFVLHVEVFPVNDEPPVLKADLMPVM
NCSEGGEVVITSEYIFATDVDSDNLKLMFVIAREPQHGVVRRAGVTVDQFSQRDVISEAV
TYKHTGGEIGMMPCFDTITLVVSDGEAGPFVNVCCYNGPNPSVPLHASFPVYDLNITVYP
VDNQPPSIAIGPTFVVNEGCSRALTVNHLSATDPDTAADDLEFVLVSPPQFGYLENILPS
VGFEKSNIGISIDSFQWKDMNAFHINYVQSRHLRIEPTADQFTVYVTDGKQHSLEIPFSV
IINPTNDEAPDFVVQNITVCEGQMKELDSSIISAVDLDIPQDALLFSITQKPRHGLLIDR
GFSKDFSENKQPASPHQKHAPVHSFSMELLKTGMRLTYMHDDSESLADDFIIQLSDGKHK
ILKTISVEVTPVNDEKPVLSKKAEIAMNMGETRIISSAILSAIDEDSPREKIYYVFERLP
QNGQLQLKIGRDWVPLSPGMKCTQEEVDLNLLRYSHTGAMDSQNQDSFTFYLWDGDNRSP
ALDCQITIKDMEKGDIVILTKPLVVSKGDRGFLTTTTLLAVDGTDKPEELLYVITSPPRY
GQIEYVHYPGVPITSFSQMDIVGQTVCYVHKSKVTVSSDRFRFIISNGLRTEHGVFEITL
ETADRALPVVTRNKGLRLAQGAVGLLSPDLLQLTDPDTPAENLTFLLVQLPQHGQLYLWG
TGLLQHNFTQQDVDSRNVAYRHSGGDSQTDCFTFMATDSTNQGFIVNGRVWEKPVLFTIQ
VDQLDKTAPRITLLHSPSQVGLLKNGCYGLYITSRVLKASDPDTEDDQIIFKILQGPKHG
HLENTTTGEFIREKFSQEDLNSKTILYIINPSLEVNSDTMEFQIMDPTGNSATPQILELK
WSHIEWSQTEYEVCENVGVLPLEIIRRGYSMDSAFVGIKVNQVSATVGKDFTVTPSKLIQ
FDPGMSTKMWNIAITYDGLEEDDEVFEVILNSPVNAVLGTKTKAAVKILDSKGGQCHPSY
SSNQSKHSTWEKGIWRLLPPGSSSSTTSGSFHLERRPLPSSMQLAVTRGDTLQGFDSTDL
SQRKLRTRGNGKTVRPSSVYRNGTDIIYNYHGIVSLKLEDDSFPTHKRKAKVSIISQPQK
TIKVAELPQADKVESTTDSHFPRQDQLPSFPKNCTLELKGLFHFEEGIQKLYQCNGIAWK
AWSPQTKDVEDKSCPAGWHQHSGYCHILITEQKGTWNAAAQACREQYLGNLVTVFSRQHM
RWLWDIGGRKSFWIGLNDQARAGHWEWIGGEPVAFTNGRRGPSQRSKLGKSCVLVQRQGK
WQTKDCRRAKPHNYVCSRKL
Download sequence
Identical sequences H2PS51
9600.ENSPPYP00000021517 ENSPPYP00000021517 ENSPPYP00000021517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]