SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021608 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021608
Domain Number 1 Region: 12-495
Classification Level Classification E-value
Superfamily ALDH-like 1.09e-183
Family ALDH-like 0.000000000000037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021608   Gene: ENSPPYG00000019292   Transcript: ENSPPYT00000022493
Sequence length 500
Comment pep:known chromosome:PPYG2:9:67652586:67705567:-1 gene:ENSPPYG00000019292 transcript:ENSPPYT00000022493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VILGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVD
KAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLN
DLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIG
PALSCGNTVVVKPAEQTPLTALHVASLVKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDK
VAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAIESAHHGVFYHQGQ
CCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESG
KKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRA
NNTFYGLSAGVFTKDIDKAVTISSALQAGTVWVNCYGVVTAQCPFGGFKMSGNGRELGEY
GFHEYTEVKTVTVKISQKNS
Download sequence
Identical sequences H2PSE0
9600.ENSPPYP00000021608 ENSPPYP00000021608 ENSPPYP00000021608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]