SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021705 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021705
Domain Number 1 Region: 443-745
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.68e-72
Family Protein kinases, catalytic subunit 0.000000465
Further Details:      
 
Domain Number 2 Region: 280-402
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-35
Family Kringle modules 0.00026
Further Details:      
 
Domain Number 3 Region: 68-156
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-21
Family I set domains 0.027
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000021705
Domain Number - Region: 174-261
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0392
Family Frizzled cysteine-rich domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021705   Gene: ENSPPYG00000019370   Transcript: ENSPPYT00000022592
Sequence length 943
Comment pep:known_by_projection chromosome:PPYG2:9:87383855:87607520:-1 gene:ENSPPYG00000019370 transcript:ENSPPYT00000022592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGSALPRRPLLCIPAVWAAAALLLSVSRTSGEVEVLDPNDPLGPLDGQDGPIPTLKGY
FLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRL
RIQDLDTTDTGYYQCVATNGMKTITATGVLFVRLGPTHSPNHNFQDDYHEDGFCQPYRGI
ACARFIGNRTIYVDSLQMQGEIENRITAAFTMIGTSTHLSDQCSQFAIPSFCHFVFPLCD
ARSRAPKPRELCRDECEVLESDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAANC
MRIGIPAERLGRYHQCYNGSGMDYRGTASTTKSGHQCQPWALQHPHSHHLSSTDFPELGG
GHAYCRNPGGQMEGPWCFTQNKNVRMELCDVPSCSPRDSSKMGILYILVPSIAIPLVIAC
LFFLVCMCRNKQKASASTPQRRQLMASPSQDMEMPLINQHKQAKLKEISLSAVRFMEELG
EDRFGKVYKGHLFGPAPGEQTQAVAIKTLKDKAEGPLREEFRHEAMLRARLQHPNIVCLL
GMVTKDQPLSMIFSYCSHGDLHEFLVMRSPHSDVGSTDDDRTVKSALEPPDFVHLVAQIA
AGMEYLSSHHVVHKDLATRNVLVYDKLNVKISDLGLFREVYAADYYKLLGNSLLPIRWMA
PEAIMYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRNRQVLPCPDDCPAW
VYALMIECWNEFPSRRPRFKDIHSRLRAWGNLSNYNSSAQTSGASNTTQTSSLSTSPVSN
VSNARYVGPKQKAPPFPQPQFIPMKGQIRPLVPPPQLYIPVNGYQPVPAYGAYLPNFYPV
QIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSNTSVADRAALLSEGTDDTHNA
PEDGAQSPVQEAEEEEEGSVPETELLGDCDTLQVDEAQVQLEA
Download sequence
Identical sequences H2PSN3
ENSPPYP00000021705 9600.ENSPPYP00000021705 ENSPPYP00000021705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]