SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021710 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021710
Domain Number 1 Region: 20-172
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.03e-48
Family Eukaryotic proteases 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021710   Gene: ENSPPYG00000019373   Transcript: ENSPPYT00000022597
Sequence length 184
Comment pep:novel chromosome:PPYG2:9:87931083:87934029:-1 gene:ENSPPYG00000019373 transcript:ENSPPYT00000022597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPPNQVATETTSSVLMEVDRGVSTVCGKPKVVGKIYGGQDAAAGQWPWQASLLYWGSHLC
GAVLIDSRWLVSTAHCFLNKSQAPENYQVLLGNTQLYHQTQHTQKMSVHRIITHPDFEKL
HPFGSDIAMLQLHLPVNFTSYIVPVCLPSQDMQLPSNVSCWITGWGMLTEDRERAPRWGP
SSSE
Download sequence
Identical sequences H2PSN8
ENSPPYP00000021710 9600.ENSPPYP00000021710 ENSPPYP00000021710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]