SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021781 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021781
Domain Number 1 Region: 2-323
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.23e-59
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000348
Further Details:      
 
Domain Number 2 Region: 318-464
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.46e-29
Family Ricin B-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021781   Gene: ENSPPYG00000019437   Transcript: ENSPPYT00000022671
Sequence length 469
Comment pep:known_by_projection chromosome:PPYG2:9:94587651:94631662:1 gene:ENSPPYG00000019437 transcript:ENSPPYT00000022671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRRLPERWNPLCKEKKYDYDNLPRTSVIIAFYNEAWSTLLRTVYSVLETSPDILLEEVI
LVDDYSDREHLKERLANELSGLPKVRLIRANKREGLVRARLLGASAARGDVLTFLDCHCE
CHEGWLEPLLQRIHEEESAVVCPVIDVIDWNTFEYLGNSGEPQIGGFDWRLVFTWHTVPE
RERIRMRSPVDVIRSPTMAGGLFAVSKKYFEYLGSYDTGMEVWGGENLEFSFRIWQCGGV
LETHPCSHVGHVFPKQAPYSRNKALANSVRAAEVWMDEFKELYYHRNPRARLEPFGDVTE
RKQLRAKLQCKDFKWFLETVYPELHVPEDRPGFFGMLQNKGLTDYCFDYNPPDENQIVGH
QVILYLCHGMGQNQFFEYTSQKEIRYNTHQPEGCIAVEAGMDTLIMHLCEETAPENQKFI
LQEDGSLFHEQSKKCVQAARKESSDSFIPLLRDCTNSNNQKWFFKERML
Download sequence
Identical sequences H2PSV7
ENSPPYP00000021781 ENSPPYP00000021781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]