SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021802 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021802
Domain Number 1 Region: 575-679,793-908
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.91e-51
Family Phosphate binding protein-like 0.000033
Further Details:      
 
Domain Number 2 Region: 126-497
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.24e-23
Family L-arabinose binding protein-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021802   Gene: ENSPPYG00000019456   Transcript: ENSPPYT00000022692
Sequence length 1120
Comment pep:known_by_projection chromosome:PPYG2:9:97483514:97680593:-1 gene:ENSPPYG00000019456 transcript:ENSPPYT00000022692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLSLWWLLSRVCLLLPPPCALVLAGVPGSSSHPQPCQILKRIGHAVRVGAVHLQPWTA
APRAASRAPDGSRAATQRDEPEPGTRRPPAPLPGARWLGSTLHGRGPPGSRKPGEGARAE
TLWPRDALLFAVDNLNRVEGLLPYNLSLEVVMAIEAGLGDLPLLPFSSPSSPWSSDPFSF
LQSVCHTVVVQGVSALLAFPQSQGEMMELDLVSLVLHIPVISIVRHEFPRESQNPLHLQL
SLENSLSSDADVTVSILTMNNWYNFSLLLCQEDWNITDFLLLTQNNSKFHLGSIINITAN
LPSTQDLLSFLQIQLESIKNSTPTVVMFGCDMESIRRIFEITTQFGVMSPELRWVLGDSQ
NVEELRTEGLPLGLIAHGKTTQSVFEHYVQDAMELVARAVATATMIQPELALIPSTMNCM
EVETTNLTSGQYLSRFLANTTFRGLSGSVRVKGSTIVSSENNFFIWNLQHDPMGKPMWTR
LGSWQGGKIVMDYGIWPEQAQRHKTHFQHPSKLHLRVVTLIEHPFVFTREVDAEGLCPAG
QLCLDPMTNDSSTLDSLFSSLHSSNDTVPIKFKKCCYGYCIDLLEKIAEDMNFDFDLYIV
GDGKYGAWKNGHWTGLVGDLLNGTAHMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTR
DTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGLTPKGRNRSKVFSFSSAL
NVCYALLFGRTVAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGI
HDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVEYLKNDPEKLD
AFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTSNISELISQYKSHGFM
DVLHDKWYKVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLL
PRIKNKSKLQYWLHTSQRLHRAINTSFVEEKQQHFKTKHVEKRSNVGLRQLTVWNTSNLS
HDNRRKYIFSDEEGQNQLGIRIHQDIPLLPRRRELPASLTTNGKADSLNVSRNSVMQELS
ELEKQIQVIRQELQLAVSRKTELEETKASGLELGPLFLSS
Download sequence
Identical sequences H2PSX7
ENSPPYP00000021802 ENSPPYP00000021802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]