SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021959 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021959
Domain Number 1 Region: 125-296
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.35e-27
Family Pentraxin (pentaxin) 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000021959
Domain Number - Region: 43-73
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00682
Family C-type lectin domain 0.039
Further Details:      
 
Domain Number - Region: 638-905
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0174
Family Rhodopsin-like 0.027
Further Details:      
 
Domain Number - Region: 103-129
Classification Level Classification E-value
Superfamily PRP4-like 0.0942
Family PRP4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021959   Gene: ENSPPYG00000019598   Transcript: ENSPPYT00000022866
Sequence length 949
Comment pep:known_by_projection chromosome:PPYG2:9:121340126:121368016:1 gene:ENSPPYG00000019598 transcript:ENSPPYT00000022866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WLHRAAVDRSGVSLGPPPTPQVNQGTPGPQVAPVAPGEVVKTAGGVCKFSGQRLSWWQAQ
ESCEQQFGHLALQPPDGALASRLRDPVWVGQREASLRRPPQRRARTTAVLVFGERTADRA
ARLRSPLPELAALTACAHVQWDCASPDPAALFSVAAPALPNTLLLRAFAEPGGVVRAALV
VRGQHAPFLSAFRADGRWHHVCATWEQRGGRWALFSDGRRRAEARGLGAGHPVPSGGILV
LGQDQDSLGGGFSVRDAFSGNLTDFHLWARALSPAQLHRARAKAPLPEGLLFRWDPGALD
VAPSLLPMVWVRLLCPVPSEECPTWNLGPRSAGSELCLEPQPFLCCYRTETYHRLQDAQS
WPGQDVISRVNALANNIVLLPDPLSEVHGALSPAEASSFLGLLEHVLVMEMAPLGPAALL
AVVRFLKRVVALGAGDPELLLTVAASDACVVSVASLVLEEVADTWLSIPVVCGPMALVES
VQRLAPLLSTTMTSEQPRMRIQHRHAGLSGVTVIHSWFTSRVFQYTPEGPDLEPQAPASS
EEANRVQRFLSTQVGSAIISSEVWDITGEVNMAVTFHLQHQAQSPLFPPHSPSPYTGAAW
ATTGCSVAALYPDSTACFCNHSTSFAILLQIYEVQRGPEEESLLKTLSFVGCGVSFCALT
TTFLLFLVAGVPKSERTTVHKNLSFSLASAEGFLMTSEWAKANEVTCVAVTVAAHFLFLV
AFSWMLVEGLLLWRKVVAVSMHPGPGMWLYHATGCGVPVGIVAVTLAMLPHDYVAAGHCW
LNVHTYAIWAFVGPVLFVLTANTCILTHVVMITVSSARRRARMSSPRPCLQQQIWTQIWA
TVKPMLVLLPVLGLTWLVGILVHLSPAWAYAAVGLNSIQGLYIFLVYAACNEELRSALQR
MAEKKVAKVLRALGVWGAAKEHSLPPSVLPLFLPPKPSTPPHPLRAPAR
Download sequence
Identical sequences H2PTC9
9600.ENSPPYP00000021959 ENSPPYP00000021959 ENSPPYP00000021959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]