SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021988 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021988
Domain Number 1 Region: 61-149
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 3.53e-34
Family Ribosomal L11/L12e N-terminal domain 0.00000649
Further Details:      
 
Domain Number 2 Region: 138-211
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 2.75e-18
Family Ribosomal protein L11, C-terminal domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021988   Gene: ENSPPYG00000019622   Transcript: ENSPPYT00000022895
Sequence length 228
Comment pep:known_by_projection chromosome:PPYG2:9:124352004:124360327:-1 gene:ENSPPYG00000019622 transcript:ENSPPYT00000022895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRASLEGWAVTTVLAIAAFSGLYPACLRGFRPLGFRLGGGQGATFFGRPEFRVHPTPA
ASTMPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLR
ITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMR
HRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS
Download sequence
Identical sequences H2PTF8
ENSPPYP00000021988 ENSPPYP00000021988 XP_009243147.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]