SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022162 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022162
Domain Number 1 Region: 1454-1593
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.26e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000218
Further Details:      
 
Domain Number 2 Region: 231-335
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000572
Family Calponin-homology domain, CH-domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022162   Gene: ENSPPYG00000019763   Transcript: ENSPPYT00000023073
Sequence length 1598
Comment pep:known_by_projection chromosome:PPYG2:9:132730598:132826752:-1 gene:ENSPPYG00000019763 transcript:ENSPPYT00000023073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASPDGAADLVPLDRYDAARAKIAANLQWICAKAYGRDNIPEDLRDPFYVDQYEQEHIK
PPVIKLLLSSELYCRVCSLILKGDQVAALQGHQSVIQALSRKGIYVMESDDTPVTESDLS
RAPIKMSAHMAMVDALMMAYTVEMISIEKVVASVKRFSTFSASKELPYDLEDAMVFWINK
VNLKMREITEKEVKLKQQLLESPAHQKSPSKWYWKLVPVRYRREHLSARQSPYFPLLEDL
MRDGSDGAALLAVIHYYCPEQMKLDDICLKEVTSMADSLYNIRLLREFSNEYLNKCFYLT
LEDMLYAPLVLKPNVMVFIAELFWWFENVKPDFVQPRDVQELKDAKTVLHQKSSRPPVPI
SNATKRSFLGSPAAGTPADLQPPAQLLAEGCHRQYLHPEEPEYLGKGTAAFSPSHPLLPL
RQKQQKSIQGEDIPDQRHRSNSLTRVDGQPRGAAIAWPEKKTRPASQPTPFALHHAASCE
VDPSSGDSISLARSISKDSLASNIVNLTPQNQPHPTATKTHGKSLLSNVSIEDEEEELVA
IVRADVAPQQADPEFPRASPRALGLIANARSPQGQLDTSESKPDSFFLEPLMPAVLKPAK
EKQVITKEDERGEGRPRSITSRRPSEGPQPLVRRKMTGSRDLNRTFTPIPCSEFPMGIDP
TETGPQAVETAGEVCGGPLALGGFDPFPQGPSTDGFFLHVGRADEDTEGRLYVSCSKSPN
SHDSEPWTLLRQDSDSDVVDIEEAEHDFMGEAHPVVLSRYIGEEESAKLQEDMKVKEHED
KDDASGRSSPCLSTASQMSSVSMASGSVKMTSFAERKLQRLNSCETKSSTSSSQKTTPDA
SESCPAPLTTWRQKREQSPSRHGRDPASLLASELVQLHMQLEEKRRAIEAQKKKMEALSA
RQRLKLGKAAFLHVVKKGKAEASPPLRPEHFAKEYSQHNGEDCGDAVSKTEDFLMKEEQR
EELLHEPQDVDKESLAFAQQHKAKDPVALHELERNKVISAALLEDTVGEVVDVNECDLSI
EKLNETISTLQQAILKISQQQEQLLMKSPTVPVPGSRNNSQDHKVKAPVHFVEPLSPTGV
AGHRKAPRLGQGRNSRSGRPAELKVPKDRPQGSSRSKTPTPSVETLPHLRPFPASSHPWT
PTDPGLDGALEPSGDPHGKCLFDSYRLHDESNQRTLTLSSSKDANILLEQMSLKEVLDAT
VKEVGPSSSDVSGKESIPVEEPLRSRASLIEVDLSDLKAPDEDGELASLDGSADLVSEGD
QKPGVGFFFKDEQKAEDELAKKRAAFLLKQQRKAEEARVRKQQLEAEVELKRDEARRKAE
EDRVRKEEEKARRELIKQEYLRRKQQQILEEQGLGKPKSKPKKPRPKSVHREESCSDSGT
KCSSTPDNLSRTQSGSSLSLASAATTEPESVHSGGTPSQRVESMEALPILSRNASRSTDR
DWETASAASSLASVAEYTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKNSILEEL
EKCDANHYIILFRDAGCQFRALYCYYPDTEEIYKLTGTGPKSITKKMIDKLYKYSSDRKQ
FNLIPAKTMSVSVDALTIHNHLWQPKRPAVPKKAQTRK
Download sequence
Identical sequences H2PTX8
ENSPPYP00000022162 ENSPPYP00000022162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]