SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022238 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022238
Domain Number 1 Region: 7-147
Classification Level Classification E-value
Superfamily E set domains 4.06e-21
Family Arrestin/Vps26-like 0.022
Further Details:      
 
Domain Number 2 Region: 147-296
Classification Level Classification E-value
Superfamily E set domains 9.8e-17
Family Arrestin/Vps26-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022238   Gene: ENSPPYG00000019835   Transcript: ENSPPYT00000023152
Sequence length 396
Comment pep:known_by_projection chromosome:PPYG2:9:134636818:134648357:1 gene:ENSPPYG00000019835 transcript:ENSPPYT00000023152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERVQLFEISLKQGRVVYSPGEPLAGTVRVRLGAPMPFRAIRVTCTGSCGVSNKANDTAW
VVEEGYFNSSLSLADKGSLPAGEHSFPFQFLLPATAPTSFEGPFGKIVHQVRATIHTPRF
SKDHKCSLVFYILSPLNLNSIPDIEQPNVASATKKFSYKLVKTGSVVLTASTDLRGYVVG
QALQLHADIENQSGKDTSPVVASLLQKVSYKAKRWIHDVRTIAEVEGAGVKAWRRAQWHE
QILVPALPQSALPGCSLIHIDYYLQVSLKAPEATVTLPVFIGNIAVNHAPLSPRPGLGLP
PGAPPLVVPSAPPQEEAEAAAGGLQFLDPVFLSTKSHSQQQPLLATLSSVPGAPEPCPQD
GSPASHPLHPPLCISTVPLSPTLQRAPGGQCPPPAP
Download sequence
Identical sequences H2PU53
ENSPPYP00000022238 ENSPPYP00000022238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]