SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022389 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022389
Domain Number 1 Region: 6-191
Classification Level Classification E-value
Superfamily ALDH-like 6.28e-41
Family ALDH-like 0.00000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022389   Gene: ENSPPYG00000020004   Transcript: ENSPPYT00000023329
Sequence length 196
Comment pep:novel chromosome:PPYG2:Un:13141237:13145873:1 gene:ENSPPYG00000020004 transcript:ENSPPYT00000023329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFEDTLRRLREAFHAGRTRPAEFRAAQLRGLGRFLQENKQLLHDALAQDLHKSAFESE
VSEVAISQGEVTLALRNRAWMKDERVPKNLATQLDSAFIRKEPFGLVLIIAPWNYPLNLT
LVPLVGALAAGNCVVLKPSEISKSVEKVLAEVLPQYLDQSCFAVVLGGPQETGQLLEHRF
DYIFFTGEAGTRVGTG
Download sequence
Identical sequences H2PUK2
ENSPPYP00000022389 ENSPPYP00000022389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]