SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022425 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022425
Domain Number 1 Region: 134-248
Classification Level Classification E-value
Superfamily C-type lectin-like 1.29e-30
Family C-type lectin domain 0.0000041
Further Details:      
 
Domain Number 2 Region: 104-129
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.0000000595
Family Triple coiled coil domain of C-type lectins 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022425   Gene: ENSPPYG00000020044   Transcript: ENSPPYT00000023372
Sequence length 248
Comment pep:novel chromosome:PPYG2:Un:35399942:35402213:1 gene:ENSPPYG00000020044 transcript:ENSPPYT00000023372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLCPLALTLTLMAASGAACEVKDICVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPM
GPPGEMPCPPGNDGLPGAPGVPGKRGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQ
TRGALSLQGSIMTVGEKVFSTNGQSVTFDAIQEACARAGGRIAVPRNPEENEAIASFVKK
YNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLQ
YRLTICEF
Download sequence
Identical sequences H2PUN8
9600.ENSPPYP00000022425 ENSPPYP00000022425 ENSPPYP00000022425 XP_003780302.1.23681 XP_009235308.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]