SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022458 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022458
Domain Number 1 Region: 12-166
Classification Level Classification E-value
Superfamily ITPase-like 5.1e-43
Family Maf-like 0.000041
Further Details:      
 
Domain Number 2 Region: 325-562
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000000000351
Family Plant O-methyltransferase, C-terminal domain 0.027
Further Details:      
 
Domain Number 3 Region: 243-323
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000204
Family Plant O-methyltransferase, N-terminal domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022458   Gene: ENSPPYG00000020082   Transcript: ENSPPYT00000023415
Sequence length 573
Comment pep:known_by_projection chromosome:PPYG2:X:1353004:1413341:-1 gene:ENSPPYG00000020082 transcript:ENSPPYT00000023415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLCPVIGKLLHKRVVLASASPRRQEILSNAKDLRTPDVVIGADTIVTVGGLILEKPVDK
QDAYRMLSRLSGREHSVFTGVAIVHCSSKEHQLDTRVSEFYEETKVKFSELSEELLWEYI
HSGEPMDKAGGYGIQALGGMLVESVHGDFLNVVGFPLNHFCKQLVKLYYPPRPEDLRRRV
KHNSIPAVDTFEDLSDVEGSGSEPAQRDTGSCDEKAQAGEAGQAAAEAECHRTQETLPPF
PTRLLELIDGFMLSKALFTACKLKVFDLLKDEAPQKAADIASKVDTSVCGMERLLNICAA
MGLLEKTEQGDRTQRTANLYLASDGEYSLHGIIMHKNDLTCNLFTYLEFAIREGTHQHHW
LLGKKVEDLFQDAYYQSPETRLRFMRAMHSMVKLTACQVATAFDLSRFSSACDVGATASG
LLTTLCHLSVICLSFIIYPSIHHLPTHHLPSIHTSIHLIHAVLGSLCSPFSSPVACCVPC
VPLKDPRLAVQDSSSLLFPSGAGLLLVEMLLDEEKRVAQRALMQSLDMLVQTEGRERSPG
EYQCLLELHGFHQVQVVHLGGVLDAILATKVAP
Download sequence
Identical sequences H2PUS1
ENSPPYP00000022458 ENSPPYP00000022458 9600.ENSPPYP00000022458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]