SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022538 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022538
Domain Number 1 Region: 27-64,93-149
Classification Level Classification E-value
Superfamily Carbonic anhydrase 0.0000000000628
Family Carbonic anhydrase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022538   Gene: ENSPPYG00000020148   Transcript: ENSPPYT00000023496
Sequence length 195
Comment pep:novel chromosome:PPYG2:X:15654774:15669192:1 gene:ENSPPYG00000020148 transcript:ENSPPYT00000023496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQPPASTSGIMGTLSSWNLKILQINQLHLVHWNAVKFENFEDAALEENGLAVIGVFLKI
SETSDSPVSTGRPKLLARKLHPAQKHWALQSRPFLSSQVQENCKVTYFHRKRWVCIRPLP
TTPPSWDCARICIQREMVPARIRVLRQMVLEAWRCFPNRLPLLSDIRPDFSKARLAYMKW
WLWSARHPHSLSAAW
Download sequence
Identical sequences H2PUZ7
ENSPPYP00000022538 9600.ENSPPYP00000022538 ENSPPYP00000022538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]