SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022745 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022745
Domain Number 1 Region: 10-135
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 4.79e-23
Family Extradiol dioxygenases 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022745   Gene: ENSPPYG00000020318   Transcript: ENSPPYT00000023707
Sequence length 138
Comment pep:known_by_projection chromosome:PPYG2:X:49572186:49580213:1 gene:ENSPPYG00000020318 transcript:ENSPPYT00000023707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WRDSSQTPPPCLIRRLDHIVMTVKSIKDTTVFYSKILGMEVMTFKEDRKALCFGDQKFNL
HEVGKEFEPKAAHPVPGSLDICLITEVPLEEMIQHLKACDVPIEEGPVPRTGAKGPIMSI
YFRDPDRNLIEVSNYISS
Download sequence
Identical sequences H2PVJ6
ENSPPYP00000022745 9600.ENSPPYP00000022745 ENSPPYP00000022745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]