SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023083 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023083
Domain Number 1 Region: 1574-1687
Classification Level Classification E-value
Superfamily C-type lectin-like 1.27e-44
Family Noncollagenous (NC1) domain of collagen IV 0.00000273
Further Details:      
 
Domain Number 2 Region: 1468-1573
Classification Level Classification E-value
Superfamily C-type lectin-like 1.48e-42
Family Noncollagenous (NC1) domain of collagen IV 0.00000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023083   Gene: ENSPPYG00000020620   Transcript: ENSPPYT00000024053
Sequence length 1689
Comment pep:known_by_projection chromosome:PPYG2:X:107155239:107434009:-1 gene:ENSPPYG00000020620 transcript:ENSPPYT00000024053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPGLWLLLVTLCLTEELAGAGEKSYGKPCGGQDCRRSCQCFPEKGARGRPGPIGIQGPT
GPQGFTGSTGLSGLKGERGSPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPP
GLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDG
ITGPQGALGSPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGP
PPSTGELEFMGFPKGQKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGP
RGPMGSEGVHGPPGQQGKKGTLGFPGLNGFGMEGQKGDIGLPGPDVFIDIDGAVISGNPG
DPGVPGLPGLKGDEGIQGLRGPSGAPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIGA
AGLPGRDGLPGPPGPPGPPSPEFETETLHNKEPGFPGLRGEQGPKGNPGLKGIKGDSGFC
ACDGGVPNTGPPGEPGPPGPRGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPK
GKKGEPILSTIQGMPGDRGDSGSQGFHGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKG
LPGLPGEKGHPGPPGLPGIGLPGLPGPPGLPGDKGNDGLPGQQGLPGSKGITLPCIIPGS
YGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGTKGEPGSPGLVHLPELPGFPGPRGEKGL
PGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAESGAPGEQGLQGLTGDKGFLGDSGLP
GLKGVHGKPGLLGPKGEQGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHP
GKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGSKGEKGSV
GFVGFPGIPGLPGIPGTRGLKGIPGSAGKMGPSGHAGTPGEKGDRGNPGPVGIPSPRRPM
SNLWLKGDKGSQGSAGSGGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGF
MGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPG
PKGQPGESGLKGTKGRDGLIGNIGFPGNKGEDGKIGVSGDVGLPGAPGFPGVAGMRGEPG
LQGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGL
PGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPG
RPGLDGERGRPGPPGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELG
LKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGPQGAPGQTPTAEAVQVPPGPL
GLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPP
GFEGAPGQQGPFGMPGMPGQSVRVGYTLVKHSQSEQVPLCPIGMSQLWVGYSLLFVEGQE
KAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPMMPVSQTQIP
QYISRCSVCEAPSQAIAVHSQDITIPQCPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPG
SCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETLKAGQLHTRVS
RCQVCMKSL
Download sequence
Identical sequences H2PWG3
ENSPPYP00000023083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]