SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023086 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023086
Domain Number 1 Region: 1575-1687
Classification Level Classification E-value
Superfamily C-type lectin-like 5.65e-47
Family Noncollagenous (NC1) domain of collagen IV 0.0000016
Further Details:      
 
Domain Number 2 Region: 1463-1572
Classification Level Classification E-value
Superfamily C-type lectin-like 3.77e-44
Family Noncollagenous (NC1) domain of collagen IV 0.00000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023086   Gene: ENSPPYG00000020622   Transcript: ENSPPYT00000024056
Sequence length 1688
Comment pep:known_by_projection chromosome:PPYG2:X:107435569:107694021:1 gene:ENSPPYG00000020622 transcript:ENSPPYT00000024056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLRGVSLAAGLFLLALSLWGQPAEAAACYGCSPGSKCDCSGIKGEKGERGFPGLEGHPG
LPGFPGPEGPPGPRGQKGDDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGHDGAPGPQG
IPGCNGTKGERGFPGSPGFPGLQGPPGPPGIPGMKGEPGSIIMSSLPGPKGNPGYPGPPG
IQGLPGPTGIPGPIGPPGPPGLMGPPGPPGLPGPKGNMGLNFQGPKGEKGEQGLQGPPGP
PGQISEQKRPIDVEFQKGDQGLPGDRGPPGPPGIRGPPGPPGGEKGEKGEQGEPGKRGKP
GKDGENGQPGIPGLPGDPGYPGEPGRDGEKGQKGDTGPPGPPGLVIPRPGTGITIGEKGN
IGLPGLPGEKGERGFPGIQGPPGLPGPPGAAVMGPPGPPGFPGERGQKGDEGPPGISIPG
PPGLDGQPGAPGLPGPPGPPGPHIPPSDEICEPGPPGPPGSPGDKGLQGEQGVKGDKGDT
CFNCIGTGISGPPGQPGLPGLPGPPGSLGFPGQKGEKGQAGATGPKGLPGIPGAPGAPGF
PGSKGEPGDILTFPGMKGDKGELGSPGAPGLPGLPGTPGQDGLPGLPGPKGEPGGITFKG
ERGPPGNPGLPGLPGNIGPMGPPGFGPPGPVGEKGIQGVAGNPGQPGIPGPKGDPGQTIT
QPGKPGLPGNPGRDGEVGLPGDPGLPGQPGLPGIPGSKGEPGIPGIGLPGPPGPKGFPGI
PGPPGAPGTPGRIGLEGPPGPPGFPGPKGEPGFALPGPPGPPGLPGFKGTLGPKGDRGFP
GPPGPPGRTGLDGLPGPKGDVGPNGQPGPMGPPGLPGIGVQGPPGPPGIPGPIGQPGLHG
IPGEKGDPGPPGLDVPGPPGERGSPGIPGAPGPIGPPGSPGLPGKAGASGFPGTKGEMGM
MGPPGPPGPLGIPGRSGVPGLKGDDGLQGQPGLPGPAGEKGSKGEPGLPGPPGPMDPNLL
GSKGEKGEPGLPGIPGVSGPKGYQGLPGDPGQPGLSGQPGLPGPPGPKGNPGLPGQPGLT
GPPGLKGAIGDMGFPGPQGVEGPPGPSGVPGQPGSPGLPGQKGDKGDPGISSIGLPGLPG
PKGEPGLPGYPGNPGIKGSVGDPGLPGLPGTPGAKGQPGLPGFPGTPGPPGPKGISGPPG
NPGLPGEPGPVGGGGRPGQPGPPGEKGKPGQDGIPGPAGQKGEPGQPGFGTPGPPGLPGL
SGQKGDGGLPGIPGNPGLPGPKGEPGFHGFPGVQGPPGPPGSPGPALEGPKGNPGPQGPP
GRPGFQGLPGPEGSPGLPGNGAIKGEKGNPGQPGLPGLPGLKGDQGPPGLQGNPGRPGLN
GMKGDPGLPGVPGFPGMKGPSGVPGSAGPEGEPGLIGPPGPPGLPGPSGQSIIIKGDSGP
PGIPGQPGLKGLPGLQGPQGLPGPTGPPGDPGRNGLPGFDGAGGRKGDPGLPGQPGTRGL
DGPPGPDGLQGPPGPPGTSSIAHGFLITRHSQSTDAPQCPQGTLQVYEGFSLLYVQGNKR
AHGQDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPEPMPMSMQPLKGQSI
QPFISRCAVCEAPAVVIAVHSQTIQIPHCPQGWDSLWIGYSFMMHTSAGAEGSGQALASP
GSCLEEFRSAPFIECHGRGTCNYYANSYSFWLATVDVSDMFSKPQSETLKAGDLRTRISR
CQVCMKRT
Download sequence
Identical sequences H2PWG6
ENSPPYP00000023086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]