SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023156 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023156
Domain Number 1 Region: 92-178
Classification Level Classification E-value
Superfamily PUA domain-like 9.32e-19
Family PUA domain 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000023156
Domain Number - Region: 51-88
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.0981
Family Hypothetical protein APE0525, N-terminal domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023156   Gene: ENSPPYG00000020687   Transcript: ENSPPYT00000024127
Sequence length 181
Comment pep:known_by_projection chromosome:PPYG2:X:119632764:119641104:1 gene:ENSPPYG00000020687 transcript:ENSPPYT00000024127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIE
ILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPG
AKLYPAAVDTVVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTY
K
Download sequence
Identical sequences A0A1S3A741 H2PWN4
XP_003779765.1.23681 XP_007530422.1.11023 ENSPPYP00000023156 9600.ENSPPYP00000023156 ENSPPYP00000023156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]