SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023188 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023188
Domain Number 1 Region: 476-606
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 3.74e-55
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000166
Further Details:      
 
Domain Number 2 Region: 125-345
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.44e-37
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000466
Further Details:      
 
Domain Number 3 Region: 297-473
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.43e-21
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000639
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023188   Gene: ENSPPYG00000020712   Transcript: ENSPPYT00000024159
Sequence length 611
Comment pep:known_by_projection chromosome:PPYG2:X:129544424:129581687:-1 gene:ENSPPYG00000020712 transcript:ENSPPYT00000024159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPLELQMTRQMASSGAS
GGKIDNSVLVLIVGLSTVGAGAYVSRKAACIKKLPNRESSETSRRFIQSVLLLSASEGEE
VPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFS
DDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNM
VKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKS
ITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVK
VMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFR
VNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMF
WSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEIT
IPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLN
EVAKLFNIHED
Download sequence
Identical sequences H2PWR6
ENSPPYP00000023188 9600.ENSPPYP00000023188 ENSPPYP00000023188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]