SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023262 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023262
Domain Number 1 Region: 213-459
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.66e-86
Family Eukaryotic proteases 0.0000000102
Further Details:      
 
Domain Number 2 Region: 48-110
Classification Level Classification E-value
Superfamily GLA-domain 2.55e-25
Family GLA-domain 0.0000916
Further Details:      
 
Domain Number 3 Region: 134-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000658
Family EGF-type module 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023262   Gene: ENSPPYG00000020779   Transcript: ENSPPYT00000024234
Sequence length 461
Comment pep:known_by_projection chromosome:PPYG2:X:139168866:139208548:1 gene:ENSPPYG00000020779 transcript:ENSPPYT00000024234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRVNMIMAESPGLITICLLGYLLSAECTVFLDHENANKILNRPKRYNSGKLEEFVQGNL
ERECMEEKCSFEEAREVFENTERTTEFWKQYVDGDQCESNPCLNGGSCKDDINSYECWCP
FGFEGKNCELDVTCNIKNGRCKQFCKNSADNKVICSCTEGYRLAENQKSCEPAVPFPCGR
VSVSQTSKLTRAETVFPDVDYVNSTEAETILDNITQSTQSFNDFTRVVGGEDAKPGQFPW
QVVLNGRRDAFCGGSIVNEKWIVTAAHCIETGDKITVVAGEHNIEETEHTEQKRNVIRII
PHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYTNIFLKFGSGFVSGWGRVF
NKGRSASILQYLRVPLVDRATCLRSTKFTIYNNMFCAGFHEGGRDSCQGDSGGPHVTEVE
GTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT
Download sequence
Identical sequences H2PWY7
9600.ENSPPYP00000023262 ENSPPYP00000023262 ENSPPYP00000023262 XP_002832230.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]