SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023326 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023326
Domain Number 1 Region: 3-227
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.56e-56
Family DnaQ-like 3'-5' exonuclease 0.00000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023326   Gene: ENSPPYG00000020842   Transcript: ENSPPYT00000024303
Sequence length 236
Comment pep:known_by_projection chromosome:PPYG2:X:153668144:153668854:-1 gene:ENSPPYG00000020842 transcript:ENSPPYT00000024303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEPPRAETFVFLDLEATGLPSVEPEIAELSLFAVHRSSLENPERDESGALVLPRVLDKL
TLCMCPERPFTAKASEITGLSSEGLARCRKSGFDGAVVRTLQAFLSRQAGPICLVAHNGF
DYDFPLLCAELRRLGARLPRDTVCLDTLPALRGLDRAHSHGTRARGRQGYSLGSLFHRYF
RAEPSAAHSAEGDVHTLLLIFLHRAAELLAWADEQACGWAHIEPMYLPPDDPSLEA
Download sequence
Identical sequences H2PX49
9600.ENSPPYP00000023326 ENSPPYP00000023326 ENSPPYP00000023326 XP_009233676.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]