SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023426 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023426
Domain Number 1 Region: 3-172
Classification Level Classification E-value
Superfamily E set domains 2.13e-75
Family Arrestin/Vps26-like 0.000000419
Further Details:      
 
Domain Number 2 Region: 176-364
Classification Level Classification E-value
Superfamily E set domains 1.36e-55
Family Arrestin/Vps26-like 0.00000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023426   Gene: ENSPPYG00000020927   Transcript: ENSPPYT00000024406
Sequence length 388
Comment pep:known_by_projection chromosome:PPYG2:X_random:8467488:8480150:1 gene:ENSPPYG00000020927 transcript:ENSPPYT00000024406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYLKGRKLFVMLTCAFRYG
RDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNL
PCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPS
AQTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVL
YSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQKRGLALDGKLKHEDTNLASS
TIIRPGMDKELLGILVSYKVRVNLMVSCGGILGDLTASDVGVELPLVLIHPKPSHASASS
EDIVIEEFTRKGEEESQKAVEAEGDEGS
Download sequence
Identical sequences A0A2J8L3F5 H2PXE4
ENSPPYP00000023426 ENSPPYP00000023426 9598.ENSPTRP00000037795 9600.ENSPPYP00000023426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]