SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023458 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023458
Domain Number 1 Region: 14-112
Classification Level Classification E-value
Superfamily DNA clamp 0.000000785
Family DNA polymerase processivity factor 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023458   Gene: ENSPPYG00000025821   Transcript: ENSPPYT00000029300
Sequence length 279
Comment pep:novel chromosome:PPYG2:7:35979252:35993388:1 gene:ENSPPYG00000025821 transcript:ENSPPYT00000029300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFRAKIVDGACLNHFTRISNMIAKLAKTCTLRISPDKLNFILCDKLANGGVSMWCELEQ
ENFFNEFQMEGVSAENNEIYLELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSVELL
SMSSSSRIVTHDIPVKVIPRKLWKDLQEPVVPDPDVSIYLPVLKTMKSVVEKMKNISNHL
VIEANLDGELNLKIETELVCVTTHFKDLGNPPLASESTQKNRNVEHMAEVHIDIRKLLQF
LAGQQVNPTKALCNIVSNKMVHFDLLHEDVSLQYFIPAL
Download sequence
Identical sequences H2PXG5
9600.ENSPPYP00000023458 ENSPPYP00000023458 ENSPPYP00000023458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]