SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023486 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023486
Domain Number 1 Region: 3-130
Classification Level Classification E-value
Superfamily ARM repeat 1.27e-54
Family Eukaryotic translation initiation factor 3 subunit 12, eIF3k, N-terminal domain 0.00000028
Further Details:      
 
Domain Number 2 Region: 132-166
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000158
Family Eukaryotic translation initiation factor 3 subunit 12, eIF3k, C-terminal domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023486   Gene: ENSPPYG00000025857   Transcript: ENSPPYT00000029336
Sequence length 176
Comment pep:known_by_projection chromosome:PPYG2:19:39487281:39504154:1 gene:ENSPPYG00000025857 transcript:ENSPPYT00000029336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAF
FQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQA
LDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSGVSSIMASSQ
Download sequence
Identical sequences H2PXJ3
9600.ENSPPYP00000023486 ENSPPYP00000023486 ENSPPYP00000023486 XP_007994893.1.81039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]