SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023552 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023552
Domain Number 1 Region: 24-499
Classification Level Classification E-value
Superfamily ALDH-like 9.56e-136
Family ALDH-like 0.00000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023552   Gene: ENSPPYG00000025927   Transcript: ENSPPYT00000029406
Sequence length 511
Comment pep:known_by_projection chromosome:PPYG2:5:127897353:127949436:-1 gene:ENSPPYG00000025927 transcript:ENSPPYT00000029406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTLLINQPQYAWLKELGLREENEGVYNGSWGGQGEVITTYCPANNEPIARVRQASVADY
EETIKKAREAWKIWADIPAPKRGEIVRQIGDALREKIQVLRSLVSLEMGKILVEGVGEVQ
EYVDICDYAVGLSRMIGGPILPSERPGHALIEQWNPVGLVGIITAFNFPVAVYGWNNAIA
MICGNVCLWKGAPTTSLISVAVTKIIAKVLEDNKLPGAICSLTCGGADIGTAMAKDERVN
LLSFTGSTQVGKQVALMVQERFGRSLLELGGNNAIIAFEDADLSLVVPSALFAAVGTAGQ
RCTTVRRLFVHESIHDEVVNRLKKAYAQIRVGNPWDSNVLYGPLHTKQAVSMFLGAVEEA
KKEGGTVVYGGKVMDRPGNYVEPTIVTGLAHDASIAHTETFAPILYVFKFKNEEEVFAWN
NEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRES
GSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
Download sequence
Identical sequences H2PXQ8
9600.ENSPPYP00000023552 ENSPPYP00000023552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]